PDB entry 1q0m

View 1q0m on RCSB PDB site
Description: Crystal structure of Ni-containing superoxide dismutase with Ni-ligation corresponding to the state after full x-ray-induced reduction
Class: oxidoreductase
Keywords: homohexamer of four-helix bundles, oxidoreductase
Deposited on 2003-07-16, released 2004-05-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.68 Å
R-factor: 0.177
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Superoxide dismutase [Ni]
    Species: Streptomyces seoulensis [TaxId:73044]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1q0ma_
  • Chain 'B':
    Compound: Superoxide dismutase [Ni]
    Species: Streptomyces seoulensis [TaxId:73044]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1q0mb_
  • Chain 'C':
    Compound: Superoxide dismutase [Ni]
    Species: Streptomyces seoulensis [TaxId:73044]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1q0mc_
  • Chain 'D':
    Compound: Superoxide dismutase [Ni]
    Species: Streptomyces seoulensis [TaxId:73044]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1q0md_
  • Chain 'E':
    Compound: Superoxide dismutase [Ni]
    Species: Streptomyces seoulensis [TaxId:73044]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1q0me_
  • Chain 'F':
    Compound: Superoxide dismutase [Ni]
    Species: Streptomyces seoulensis [TaxId:73044]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1q0mf_
  • Heterogens: NI, SO4, ACY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1q0mA (A:)
    hcdlpcgvydpaqarieaesvkaiqekmaanddlhfqiratvikeqraelakhhldvlws
    dyfkpphfesypelhtlvneavkalsaakastdpatgqkaldyiaqidkifwetkka
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1q0mB (B:)
    hcdlpcgvydpaqarieaesvkaiqekmaanddlhfqiratvikeqraelakhhldvlws
    dyfkpphfesypelhtlvneavkalsaakastdpatgqkaldyiaqidkifwetkka
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1q0mC (C:)
    hcdlpcgvydpaqarieaesvkaiqekmaanddlhfqiratvikeqraelakhhldvlws
    dyfkpphfesypelhtlvneavkalsaakastdpatgqkaldyiaqidkifwetkka
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1q0mD (D:)
    hcdlpcgvydpaqarieaesvkaiqekmaanddlhfqiratvikeqraelakhhldvlws
    dyfkpphfesypelhtlvneavkalsaakastdpatgqkaldyiaqidkifwetkka
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1q0mE (E:)
    hcdlpcgvydpaqarieaesvkaiqekmaanddlhfqiratvikeqraelakhhldvlws
    dyfkpphfesypelhtlvneavkalsaakastdpatgqkaldyiaqidkifwetkka
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1q0mF (F:)
    hcdlpcgvydpaqarieaesvkaiqekmaanddlhfqiratvikeqraelakhhldvlws
    dyfkpphfesypelhtlvneavkalsaakastdpatgqkaldyiaqidkifwetkka