![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies) core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down |
![]() | Superfamily a.24.22: Nickel-containing superoxide dismutase, NiSOD [109770] (1 family) ![]() automatically mapped to Pfam PF09055 |
![]() | Family a.24.22.1: Nickel-containing superoxide dismutase, NiSOD [109771] (2 proteins) |
![]() | Protein Nickel-containing superoxide dismutase, NiSOD [109772] (2 species) |
![]() | Species Streptomyces seoulensis [TaxId:73044] [109773] (5 PDB entries) Uniprot P80734 |
![]() | Domain d1q0mf_: 1q0m F: [104463] complexed with acy, ni, so4 |
PDB Entry: 1q0m (more details), 1.68 Å
SCOPe Domain Sequences for d1q0mf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1q0mf_ a.24.22.1 (F:) Nickel-containing superoxide dismutase, NiSOD {Streptomyces seoulensis [TaxId: 73044]} hcdlpcgvydpaqarieaesvkaiqekmaanddlhfqiratvikeqraelakhhldvlws dyfkpphfesypelhtlvneavkalsaakastdpatgqkaldyiaqidkifwetkka
Timeline for d1q0mf_: