PDB entry 1pzl

View 1pzl on RCSB PDB site
Description: Crystal structure of HNF4a LBD in complex with the ligand and the coactivator SRC-1 peptide
Class: transcription
Keywords: transcription
Deposited on 2003-07-11, released 2004-06-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.226
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hepatocyte nuclear factor 4-alpha
    Species: Homo sapiens [TaxId:9606]
    Gene: HNF4a
    Database cross-references and differences (RAF-indexed):
    • Uniprot P41235 (Start-236)
      • engineered (4-5)
    Domains in SCOPe 2.07: d1pzla_
  • Chain 'B':
    Compound: steroid receptor coactivator-1
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • GB AAB50242 (0-13)
    Domains in SCOPe 2.07: d1pzlb_
  • Heterogens: MYR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1pzlA (A:)
    ssyelaslpsinallqaevlsrqitspvsgingdirakkiasiadvcesmkeqllvlvew
    akyipafcelplddqvallrahagehlllgatkrsmvfkdvlllgndyivprhcpelaem
    srvsirildelvlpfqelqiddneyaylkaiiffdpdakglsdpgkikrlrsqvqvsled
    yindrqydsrgrfgelllllptlqsitwqmieqiqfiklfgmakidnllqemllggs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pzlA (A:)
    laslpsinallqaevlsrqitngdirakkiasiadvcesmkeqllvlvewakyipafcel
    plddqvallrahagehlllgatkrsmvfkdvlllgndyivprhcpelaemsrvsirilde
    lvlpfqelqiddneyaylkaiiffdpdakglsdpgkikrlrsqvqvsledyindrqydsr
    grfgelllllptlqsitwqmieqiqfiklfgmakidnllqemllggs
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pzlB (B:)
    hkilhrllqegsps