Lineage for d1pzla_ (1pzl A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2728284Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2728285Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2728286Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 2728725Protein Hepatocyte nuclear factor 4-alpha [109605] (2 species)
  7. 2728726Species Human (Homo sapiens) [TaxId:9606] [109987] (1 PDB entry)
    Uniprot P41235 139-369
  8. 2728727Domain d1pzla_: 1pzl A: [104393]
    Other proteins in same PDB: d1pzlb_
    complexed with myr

Details for d1pzla_

PDB Entry: 1pzl (more details), 2.1 Å

PDB Description: crystal structure of hnf4a lbd in complex with the ligand and the coactivator src-1 peptide
PDB Compounds: (A:) Hepatocyte nuclear factor 4-alpha

SCOPe Domain Sequences for d1pzla_:

Sequence, based on SEQRES records: (download)

>d1pzla_ a.123.1.1 (A:) Hepatocyte nuclear factor 4-alpha {Human (Homo sapiens) [TaxId: 9606]}
laslpsinallqaevlsrqitspvsgingdirakkiasiadvcesmkeqllvlvewakyi
pafcelplddqvallrahagehlllgatkrsmvfkdvlllgndyivprhcpelaemsrvs
irildelvlpfqelqiddneyaylkaiiffdpdakglsdpgkikrlrsqvqvsledyind
rqydsrgrfgelllllptlqsitwqmieqiqfiklfgmakidnllqemllggs

Sequence, based on observed residues (ATOM records): (download)

>d1pzla_ a.123.1.1 (A:) Hepatocyte nuclear factor 4-alpha {Human (Homo sapiens) [TaxId: 9606]}
laslpsinallqaevlsrqitngdirakkiasiadvcesmkeqllvlvewakyipafcel
plddqvallrahagehlllgatkrsmvfkdvlllgndyivprhcpelaemsrvsirilde
lvlpfqelqiddneyaylkaiiffdpdakglsdpgkikrlrsqvqvsledyindrqydsr
grfgelllllptlqsitwqmieqiqfiklfgmakidnllqemllggs

SCOPe Domain Coordinates for d1pzla_:

Click to download the PDB-style file with coordinates for d1pzla_.
(The format of our PDB-style files is described here.)

Timeline for d1pzla_: