PDB entry 1pzj

View 1pzj on RCSB PDB site
Description: Cholera Toxin B-Pentamer Complexed With Nitrophenyl Galactoside 5
Class: toxin
Keywords: pentamer, monovalent, toxin, inhibitor, cholera
Deposited on 2003-07-11, released 2004-03-09
The last revision prior to the SCOP 1.75 freeze date was dated 2004-03-09, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.46 Å
R-factor: 0.117
AEROSPACI score: 0.83 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'D':
    Compound: cholera toxin b subunit
    Species: Vibrio cholerae
    Gene: CAA41591
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1pzjd_
  • Chain 'E':
    Compound: cholera toxin b subunit
    Species: Vibrio cholerae
    Gene: CAA41591
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1pzje_
  • Chain 'F':
    Compound: cholera toxin b subunit
    Species: Vibrio cholerae
    Gene: CAA41591
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1pzjf_
  • Chain 'G':
    Compound: cholera toxin b subunit
    Species: Vibrio cholerae
    Gene: CAA41591
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1pzjg_
  • Chain 'H':
    Compound: cholera toxin b subunit
    Species: Vibrio cholerae
    Gene: CAA41591
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1pzjh_
  • Heterogens: 15B, J15, HOH

PDB Chain Sequences:

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pzjD (D:)
    tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
    qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pzjE (E:)
    tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
    qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pzjF (F:)
    tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
    qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pzjG (G:)
    tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
    qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pzjH (H:)
    tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
    qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman