Lineage for d1pzje_ (1pzj E:)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 798661Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 798735Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) (S)
  5. 798736Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (6 proteins)
  6. 798737Protein Cholera toxin [50208] (1 species)
    barrel, partly opened; n*=5, S*=10
  7. 798738Species Vibrio cholerae [TaxId:666] [50209] (24 PDB entries)
    Uniprot P01556 22-124
  8. 798765Domain d1pzje_: 1pzj E: [95447]

Details for d1pzje_

PDB Entry: 1pzj (more details), 1.46 Å

PDB Description: cholera toxin b-pentamer complexed with nitrophenyl galactoside 5
PDB Compounds: (E:) cholera toxin b subunit

SCOP Domain Sequences for d1pzje_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pzje_ b.40.2.1 (E:) Cholera toxin {Vibrio cholerae [TaxId: 666]}
tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman

SCOP Domain Coordinates for d1pzje_:

Click to download the PDB-style file with coordinates for d1pzje_.
(The format of our PDB-style files is described here.)

Timeline for d1pzje_: