PDB entry 1pzi

View 1pzi on RCSB PDB site
Description: Heat-Labile Enterotoxin B-Pentamer Complexed With Nitrophenyl Galactoside 2a
Class: toxin inhibitor
Keywords: pentamer, monovalent, toxin, inhibitor, toxin inhibitor
Deposited on 2003-07-11, released 2004-03-09
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.99 Å
R-factor: 0.158
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'D':
    Compound: Heat-labile Enterotoxin B subunit
    Species: Escherichia coli [TaxId:562]
    Gene: ELTB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1pzid_
  • Chain 'E':
    Compound: Heat-labile Enterotoxin B subunit
    Species: Escherichia coli [TaxId:562]
    Gene: ELTB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1pzie_
  • Chain 'F':
    Compound: Heat-labile Enterotoxin B subunit
    Species: Escherichia coli [TaxId:562]
    Gene: ELTB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1pzif_
  • Chain 'G':
    Compound: Heat-labile Enterotoxin B subunit
    Species: Escherichia coli [TaxId:562]
    Gene: ELTB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1pzig_
  • Chain 'H':
    Compound: Heat-labile Enterotoxin B subunit
    Species: Escherichia coli [TaxId:562]
    Gene: ELTB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1pzih_
  • Heterogens: 1DM, HOH

PDB Chain Sequences:

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pziD (D:)
    apqtitelcseyrntqiytindkilsytesmagkremviitfksgetfqvevpgsqhids
    qkkaiermkdtlrityltetkidklcvwnnktpnsiaaismkn
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pziE (E:)
    apqtitelcseyrntqiytindkilsytesmagkremviitfksgetfqvevpgsqhids
    qkkaiermkdtlrityltetkidklcvwnnktpnsiaaismkn
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pziF (F:)
    apqtitelcseyrntqiytindkilsytesmagkremviitfksgetfqvevpgsqhids
    qkkaiermkdtlrityltetkidklcvwnnktpnsiaaismkn
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pziG (G:)
    apqtitelcseyrntqiytindkilsytesmagkremviitfksgetfqvevpgsqhids
    qkkaiermkdtlrityltetkidklcvwnnktpnsiaaismkn
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pziH (H:)
    apqtitelcseyrntqiytindkilsytesmagkremviitfksgetfqvevpgsqhids
    qkkaiermkdtlrityltetkidklcvwnnktpnsiaaismkn