PDB entry 1pzb

View 1pzb on RCSB PDB site
Description: the crystal structures of reduced pseudoazurin from alcaligenes faecalis s-6 at two ph values
Class: electron transfer(cuproprotein)
Keywords: electron transfer(cuproprotein)
Deposited on 1994-08-03, released 1994-11-30
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.177
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pseudoazurin
    Species: Alcaligenes faecalis [TaxId:511]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1pzba_
  • Heterogens: CU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1pzbA (A:)
    enievhmlnkgaegamvfepayikanpgdtvtfipvdkghnvesikdmipegaekfkski
    nenyvltvtqpgaylvkctphyamgmialiavgdspanldqivsakkpkivqerlekvia
    sak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pzbA (A:)
    enievhmlnkgaegamvfepayikanpgdtvtfipvdkghnvesikdmipegaekfkski
    nenyvltvtqpgaylvkctphyamgmialiavgdspanldqivsakkpkivqerlekvia