SCOPe 2.02: Structural Classification of Proteins

PDB entry 1pza

View 1pza on RCSB PDB site
Description: the crystal structures of reduced pseudoazurin from alcaligenes faecalis s-6 at two ph values
Class: electron transfer(cuproprotein)
Keywords: electron transfer(cuproprotein)
Deposited on 1994-09-06, released 1994-11-30
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.178
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: pseudoazurin
Species: Alcaligenes faecalis [TaxId:511]
Database cross-references and differences (RAF-indexed):
- Uniprot P04377 (0-End)
Domains in SCOPe 2.02: d1pzaa_
Heterogens: CU, HOH

PDB Chain Sequences:

Chain 'A':
Sequence, based on SEQRES records: (download)

>1pzaA (A:)
enievhmlnkgaegamvfepayikanpgdtvtfipvdkghnvesikdmipegaekfkski
nenyvltvtqpgaylvkctphyamgmialiavgdspanldqivsakkpkivqerlekvia
sak

Sequence, based on observed residues (ATOM records): (download)

>1pzaA (A:)
enievhmlnkgaegamvfepayikanpgdtvtfipvdkghnvesikdmipegaekfkski
nenyvltvtqpgaylvkctphyamgmialiavgdspanldqivsakkpkivqerlekvia