PDB entry 1pza

View 1pza on RCSB PDB site
Description: the crystal structures of reduced pseudoazurin from alcaligenes faecalis s-6 at two ph values
Deposited on 1994-09-06, released 1994-11-30
The last revision prior to the SCOP 1.61 freeze date was dated 1994-11-30, with a file datestamp of 1994-12-07.
Experiment type: -
Resolution: 1.8 Å
R-factor: 0.178
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.61: d1pza__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1pza_ (-)
  enievhmlnkgaegamvfepayikanpgdtvtfipvdkghnvesikdmipegaekfkski
  nenyvltvtqpgaylvkctphyamgmialiavgdspanldqivsakkpkivqerlekvia