PDB entry 1pyi

View 1pyi on RCSB PDB site
Description: crystal structure of a ppr1-dna complex: dna recognition by proteins containing a zn2cys6 binuclear cluster
Deposited on 1995-01-04, released 1995-02-27
The last revision prior to the SCOP 1.61 freeze date was dated 1995-02-27, with a file datestamp of 1995-02-28.
Experiment type: -
Resolution: 3.2 Å
R-factor: 0.245
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pyiA (A:)
    srtackrcrlkkikcdqefpsckrcaklevpcvsldpatgkdvprsyvffledrlavmmr
    vlkeygvdptkirgnipatsddepfdlk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pyiB (B:)
    srtackrcrlkkikcdqefpsckrcaklevpcvsldpatgkdvprsyvffledrlavmmr
    vlkeygvdpt