PDB entry 1pw3

View 1pw3 on RCSB PDB site
Description: Crystal structure of JtoR68S
Class: immune system
Keywords: Light Chain, amyloidosis, IMMUNE SYSTEM
Deposited on 2003-06-30, released 2004-08-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-04-04, with a file datestamp of 2018-03-29.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: immunoglobulin lambda chain variable region
  Species: Homo sapiens [TaxId:9606]
  Gene: Jto
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q96JD1 (0-110)
  Domains in SCOPe 2.08: d1pw3a_
• Chain 'B':
  Compound: immunoglobulin lambda chain variable region
  Species: Homo sapiens [TaxId:9606]
  Gene: Jto
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q96JD1 (0-110)
  Domains in SCOPe 2.08: d1pw3b_
• Heterogens: CD, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1pw3A (A:)
  nfmlnqphsvsespgktvtisctrssgnidsnyvqwyqqrpgsapitviyednqrpsgvp
  drfagsidsssnsasltisglktedeadyycqsydarnvvfgggtrltvlg
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1pw3B (B:)
  nfmlnqphsvsespgktvtisctrssgnidsnyvqwyqqrpgsapitviyednqrpsgvp
  drfagsidsssnsasltisglktedeadyycqsydarnvvfgggtrltvlg