PDB entry 1pw3

View 1pw3 on RCSB PDB site
Description: Crystal structure of JtoR68S
Class: immune system
Keywords: Light Chain, amyloidosis, IMMUNE SYSTEM
Deposited on 2003-06-30, released 2004-08-17
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.22
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: immunoglobulin lambda chain variable region
    Species: Homo sapiens [TaxId:9606]
    Gene: Jto
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1pw3a_
  • Chain 'B':
    Compound: immunoglobulin lambda chain variable region
    Species: Homo sapiens [TaxId:9606]
    Gene: Jto
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1pw3b_
  • Heterogens: CD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pw3A (A:)
    nfmlnqphsvsespgktvtisctrssgnidsnyvqwyqqrpgsapitviyednqrpsgvp
    drfagsidsssnsasltisglktedeadyycqsydarnvvfgggtrltvlg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pw3B (B:)
    nfmlnqphsvsespgktvtisctrssgnidsnyvqwyqqrpgsapitviyednqrpsgvp
    drfagsidsssnsasltisglktedeadyycqsydarnvvfgggtrltvlg