PDB entry 1puq

View 1puq on RCSB PDB site
Description: Solution Structure of the MutT Pyrophosphohydrolase Complexed with Mg(2+) and 8-oxo-dGMP, a Tightly-bound Product
Class: hydrolase
Keywords: mutator protein, nucleoside triphosphate pyrophosphohydrolase, mutt pyrophosphohydrolase-metal-product complex
Deposited on 2003-06-25, released 2003-08-26
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mutator mutT protein
    Species: Escherichia coli [TaxId:562]
    Gene: MUTT,STRAIN: K12-I7023
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1puqa_
  • Heterogens: MG, 8OG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1puqA (A:)
mkklqiavgiirnenneifitrraadahmanklefpggkiemgetpeqavvrelqeevgi
tpqhfslfekleyefpdrhitlwfwlverwegepwgkegqpgewmslvglnaddfppane
pviaklkrl