PDB entry 1psh

View 1psh on RCSB PDB site
Description: crystal structure of phospholipase a2 from indian cobra reveals a trimeric association
Class: carboxylic ester hydrolase
Keywords: carboxylic ester hydrolase
Deposited on 1992-07-28, released 1994-01-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.174
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phospholipase a2
    Species: Naja naja [TaxId:35670]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1psha_
  • Chain 'B':
    Compound: phospholipase a2
    Species: Naja naja [TaxId:35670]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1pshb_
  • Chain 'C':
    Compound: phospholipase a2
    Species: Naja naja [TaxId:35670]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1pshc_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1pshA (A:)
nlyqfknmikctvpsrswwdfadygcycgrggsgtpvddldrccqvhdncyneaekisgc
wpyfktysyecsqgtltckgdnnacaasvcdcdrlaaicfagapyndnnynidlkarcq

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1pshB (B:)
nlyqfknmikctvpsrswwdfadygcycgrggsgtpvddldrccqvhdncyneaekisgc
wpyfktysyecsqgtltckgdnnacaasvcdcdrlaaicfagapyndnnynidlkarcq

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1pshC (C:)
nlyqfknmikctvpsrswwdfadygcycgrggsgtpvddldrccqvhdncyneaekisgc
wpyfktysyecsqgtltckgdnnacaasvcdcdrlaaicfagapyndnnynidlkarcq