Lineage for d1pshb_ (1psh B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2338840Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 2338841Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) (S)
  5. 2338846Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 protein domains)
    automatically mapped to Pfam PF00068
  6. 2338958Protein Snake phospholipase A2 [48624] (38 species)
  7. 2339046Species Indian cobra (Naja naja) [TaxId:35670] [48626] (3 PDB entries)
  8. 2339049Domain d1pshb_: 1psh B: [19519]
    complexed with ca

Details for d1pshb_

PDB Entry: 1psh (more details), 2.3 Å

PDB Description: crystal structure of phospholipase a2 from indian cobra reveals a trimeric association
PDB Compounds: (B:) phospholipase a2

SCOPe Domain Sequences for d1pshb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pshb_ a.133.1.2 (B:) Snake phospholipase A2 {Indian cobra (Naja naja) [TaxId: 35670]}
nlyqfknmikctvpsrswwdfadygcycgrggsgtpvddldrccqvhdncyneaekisgc
wpyfktysyecsqgtltckgdnnacaasvcdcdrlaaicfagapyndnnynidlkarcq

SCOPe Domain Coordinates for d1pshb_:

Click to download the PDB-style file with coordinates for d1pshb_.
(The format of our PDB-style files is described here.)

Timeline for d1pshb_: