PDB entry 1pra

View 1pra on RCSB PDB site
Description: determination of the nuclear magnetic resonance solution structure of the DNA-binding domain (residues 1 to 69) of the 434 repressor and comparison with the x-ray crystal structure
Class: gene regulating protein
Keywords: gene regulating protein
Deposited on 1991-11-18, released 1993-10-31
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 434 repressor
    Species: Phage 434 [TaxId:10712]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1praa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1praA (A:)
    sissrvkskriqlglnqaelaqkvgttqqsieqlengktkrprflpelasalgvsvdwll
    ngtsdsnvr