PDB entry 1poh

View 1poh on RCSB PDB site
Description: the 2.0 angstroms resolution structure of escherichia coli histidine- containing phosphocarrier protein hpr: a redetermination
Deposited on 1993-10-19, released 1994-01-31
The last revision prior to the SCOP 1.61 freeze date was dated 1994-10-15, with a file datestamp of 1994-10-26.
Experiment type: -
Resolution: 2 Å
R-factor: 0.135
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.61: d1poh__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1poh_ (-)
    mfqqevtitapnglhtrpaaqfvkeakgftseitvtsngksasakslfklqtlgltqgtv
    vtisaegedeqkavehlvklmaele