PDB entry 1pis

View 1pis on RCSB PDB site
Description: solution structure of porcine pancreatic phospholipase a2
Deposited on 1994-12-22, released 1995-06-03
The last revision prior to the SCOP 1.59 freeze date was dated 1995-06-03, with a file datestamp of 1995-06-03.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.59: d1pis__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1pis_ (-)
alwqfrsmikcaipgshplmdfnnygcycglggsgtpvdeldrccethdncyrdaknlds
ckflvdnpytesysyscsnteitcnsknnaceaficncdrnaaicfskapynkehknldt
kkyc