PDB entry 1pfh

View 1pfh on RCSB PDB site
Description: the phosphorylated form of the histidine-containing phosphocarrier protein hpr
Deposited on 1995-08-18, released 1995-11-14
The last revision prior to the SCOP 1.61 freeze date was dated 1995-11-14, with a file datestamp of 1995-11-15.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.61: d1pfh__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pfh_ (-)
    mfqqevtitapnglhtrpaaqfvkeakgftseitvtsngksasakslfklqtlgltqgtv
    vtisaegedeqkavehlvklmaele