PDB entry 1pes

View 1pes on RCSB PDB site
Description: nmr solution structure of the tetrameric minimum transforming domain of p53
Class: DNA-binding
Keywords: DNA-binding
Deposited on 1994-11-24, released 1995-02-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: tumor suppressor p53
  Species: Homo sapiens [TaxId:9606]
  Gene: Human
  Database cross-references and differences (RAF-indexed):
  • Uniprot P04637 (0-30)
  Domains in SCOPe 2.07: d1pesa_
• Chain 'B':
  Compound: tumor suppressor p53
  Species: Homo sapiens [TaxId:9606]
  Gene: Human
  Database cross-references and differences (RAF-indexed):
  • Uniprot P04637 (0-30)
  Domains in SCOPe 2.07: d1pesb_
• Chain 'C':
  Compound: tumor suppressor p53
  Species: Homo sapiens [TaxId:9606]
  Gene: Human
  Database cross-references and differences (RAF-indexed):
  • Uniprot P04637 (0-30)
  Domains in SCOPe 2.07: d1pesc_
• Chain 'D':
  Compound: tumor suppressor p53
  Species: Homo sapiens [TaxId:9606]
  Gene: Human
  Database cross-references and differences (RAF-indexed):
  • Uniprot P04637 (0-30)
  Domains in SCOPe 2.07: d1pesd_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1pesA (A:)
  geyftlqirgrerfemfrelnealelkdaqa
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1pesB (B:)
  geyftlqirgrerfemfrelnealelkdaqa
  

  
  
• Chain 'C':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1pesC (C:)
  geyftlqirgrerfemfrelnealelkdaqa
  

  
  
• Chain 'D':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1pesD (D:)
  geyftlqirgrerfemfrelnealelkdaqa