PDB entry 1pds

View 1pds on RCSB PDB site
Description: Crystal Structure of NmrA, a Negative Transcriptional Regulator, in Complex with NADP at 1.7A Resolution
Class: transcription
Keywords: rossmann fold, transcriptional regulation, short chain, dehydrogenase, reductase, nadp binding, nmra
Deposited on 2003-05-20, released 2003-07-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2004-06-08, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.183
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nitrogen metabolite repression regulator nmra
    Species: Emericella nidulans
    Gene: nmrA
    Database cross-references and differences (RAF-indexed):
    • GB AAC39442 (Start-351)
      • see remark 999 (237)
    Domains in SCOPe 2.07: d1pdsa_
  • Heterogens: CL, NAP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1pdsA (A:)
    maqqkktiavvnatgrqaaslirvaaavghhvraqvhslkgliaeelqaipnvtlfqgpl
    lnnvplmdtlfegahlafinttsqagdeiaigkdladaakragtiqhyiyssmpdhslyg
    pwpavpmwapkftvenyvrqlglpstfvyagiynnnftslpyplfqmelmpdgtfewhap
    fdpdiplpwldaehdvgpallqifkdgpqkwnghrialtfetlspvqvcaafsralnrrv
    tyvqvpkveikvnipvgyreqleaievvfgehkapyfplpefsrpaagspkglgpangkg
    agagmmqgpggvisqrvtdearklwsgwrdmeeyarevfpieeeangldwml
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pdsA (A:)
    qqkktiavvnatgrqaaslirvaaavghhvraqvhslkgliaeelqaipnvtlfqgplln
    nvplmdtlfegahlafinttsqagdeiaigkdladaakragtiqhyiyssmpdhslygpw
    pavpmwapkftvenyvrqlglpstfvyagiynnnftslpyplfqmelmpdgtfewhapfd
    pdiplpwldaehdvgpallqifkdgpqkwnghrialtfetlspvqvcaafsralnrrvty
    vqvpkveikvnipvgyreqleaievvfgehkapyfplpefsggvisqrvtdearklwsgw
    rdmeeyarevfpieeeangldwml