PDB entry 1p8t

View 1p8t on RCSB PDB site
Description: Crystal structure of Nogo-66 Receptor
Class: signaling protein
Keywords: NgR, Nogo-66, SIGNALING PROTEIN
Deposited on 2003-05-07, released 2003-05-20
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: 0.265
AEROSPACI score: 0.1 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Reticulon 4 receptor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1p8ta_
  • Heterogens: NAG, NDG

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1p8tA (A:)
    cpgacvcynepkvttscpqqglqavpvgipaasqriflhgnrishvpaasfracrnltil
    wlhsnvlaridaaaftglalleqldlsdnaqlrsvdpatfhglgrlhtlhldrcglqelg
    pglfrglaalqylylqdnalqalpddtfrdlgnlthlflhgnrissvperafrglhsldr
    lllhqnrvahvhphafrdlgrlmtlylfannlsalptealaplralqylrlndnpwvcdc
    rarplwawlqkfrgsssevpcslpqrlagrdlkrlaandlqgcav