SCOPe 2.01: Domain d1p8ta_: 1p8t A:

Lineage for d1p8ta_ (1p8t A:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
   2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies

4. Superfamily c.10.2: L domain-like [52058] (9 families)
   less regular structure consisting of variable repeats

5. Family c.10.2.7: Ngr ectodomain-like [75142] (6 proteins)
   this is a repeat family; one repeat unit is 1xwd C:97-122 found in domain

6. Protein Reticulon 4 receptor (Nogo-66 receptor, Ngr) [89567] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [89568] (2 PDB entries)

8. Domain d1p8ta_: 1p8t A: [87982]
   complexed with nag, ndg

Details for d1p8ta_

PDB Entry: 1p8t, 3.2 Å

PDB Description: crystal structure of nogo-66 receptor

PDB Compounds: (A:) Reticulon 4 receptor

SCOPe Domain Sequences for d1p8ta_:

Sequence; same for both SEQRES and ATOM records:

>d1p8ta_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]}
cpgacvcynepkvttscpqqglqavpvgipaasqriflhgnrishvpaasfracrnltil
wlhsnvlaridaaaftglalleqldlsdnaqlrsvdpatfhglgrlhtlhldrcglqelg
pglfrglaalqylylqdnalqalpddtfrdlgnlthlflhgnrissvperafrglhsldr
lllhqnrvahvhphafrdlgrlmtlylfannlsalptealaplralqylrlndnpwvcdc
rarplwawlqkfrgsssevpcslpqrlagrdlkrlaandlqgcav

Timeline for d1p8ta_:

• d1p8ta_ first appeared in SCOP 1.65
  
• d1p8ta_ appears in SCOP 1.75
  
• d1p8ta_ appears in SCOPe 2.02
  
• d1p8ta_ appears in the current release, SCOPe 2.08