Lineage for d1p8ta_ (1p8t A:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 980294Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
    2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies
  4. 980347Superfamily c.10.2: L domain-like [52058] (9 families) (S)
    less regular structure consisting of variable repeats
  5. 980456Family c.10.2.7: Ngr ectodomain-like [75142] (6 proteins)
    this is a repeat family; one repeat unit is 1xwd C:97-122 found in domain
  6. 980471Protein Reticulon 4 receptor (Nogo-66 receptor, Ngr) [89567] (1 species)
  7. 980472Species Human (Homo sapiens) [TaxId:9606] [89568] (2 PDB entries)
  8. 980474Domain d1p8ta_: 1p8t A: [87982]
    complexed with nag, ndg

Details for d1p8ta_

PDB Entry: 1p8t (more details), 3.2 Å

PDB Description: crystal structure of nogo-66 receptor
PDB Compounds: (A:) Reticulon 4 receptor

SCOPe Domain Sequences for d1p8ta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p8ta_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]}
cpgacvcynepkvttscpqqglqavpvgipaasqriflhgnrishvpaasfracrnltil
wlhsnvlaridaaaftglalleqldlsdnaqlrsvdpatfhglgrlhtlhldrcglqelg
pglfrglaalqylylqdnalqalpddtfrdlgnlthlflhgnrissvperafrglhsldr
lllhqnrvahvhphafrdlgrlmtlylfannlsalptealaplralqylrlndnpwvcdc
rarplwawlqkfrgsssevpcslpqrlagrdlkrlaandlqgcav

SCOPe Domain Coordinates for d1p8ta_:

Click to download the PDB-style file with coordinates for d1p8ta_.
(The format of our PDB-style files is described here.)

Timeline for d1p8ta_: