PDB entry 1p7a

View 1p7a on RCSB PDB site
Description: Solution Stucture of the Third Zinc Finger from BKLF
Class: DNA binding protein
Keywords: classical zinc finger, kruppel-like, transcription factor, DNA binding protein
Deposited on 2003-04-30, released 2003-12-30
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Kruppel-like factor 3
    Species: Mus musculus [TaxId:10090]
    Gene: BKLF
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q60980 (6-36)
      • cloning artifact (0-5)
    Domains in SCOPe 2.04: d1p7aa_
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1p7aA (A:)
    gstrgstgikpfqcpdcdrsfsrsdhlalhrkrhmlv