PDB entry 1p4x

View 1p4x on RCSB PDB site
Description: Crystal structure of SarS protein from Staphylococcus Aureus
Class: transcription
Keywords: winged-helix protein, TRANSCRIPTION
Deposited on 2003-04-24, released 2003-07-08
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.24
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: staphylococcal accessory regulator A homologue
    Species: Staphylococcus aureus [TaxId:1280]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1p4xa1, d1p4xa2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1p4xA (A:)
mkynnhdkirdfiiieaymfrfkkkvkpevdmtikefilltylfhqqentlpfkkivsdl
cykqsdlvqhikvlvkhsyiskvrskiderntyisiseeqrekiaervtlfdqiikqfnl
adqsesqmipkdskeflnlmmytmyfkniikkhltlsfveftilaiitsqnknivllkdl
ietihhkypqtvralnnlkkqgylikerstederkilihmddaqqdhaeqllaqvnqlla
dkdhlhlvfe