PDB entry 1p22

View 1p22 on RCSB PDB site
Description: Structure of a beta-TrCP1-Skp1-beta-catenin complex: destruction motif binding and lysine specificity on the SCFbeta-TrCP1 ubiquitin ligase
Class: signaling protein
Keywords: Ubiquitination, degradation, SIGNALING PROTEIN
Deposited on 2003-04-14, released 2003-07-08
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.95 Å
R-factor: 0.233
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: F-box/WD-repeat protein 1A
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9Y297 (4-End)
      • cloning artifact (0-3)
    Domains in SCOPe 2.06: d1p22a1, d1p22a2, d1p22a3
  • Chain 'B':
    Compound: skp1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1p22b1, d1p22b2
  • Chain 'C':
    Compound: beta-catenin
    Species: Homo sapiens [TaxId:9606]
    Gene: CTNNB1 OR CTNNB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P35222
      • modified residue (14)
      • modified residue (18)

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1p22A (A:)
    spaimlqrdfitalpargldhiaenilsyldakslcaaelvckewyrvtsdgmlwkklie
    rmvrtdslwrglaerrgwgqylfknkppdgnappnsfyralypkiiqdietiesnwrcgr
    hslqrihcrsetskgvyclqyddqkivsglrdntikiwdkntleckriltghtgsvlclq
    yderviitgssdstvrvwdvntgemlntlihhceavlhlrfnngmmvtcskdrsiavwdm
    asptditlrrvlvghraavnvvdfddkyivsasgdrtikvwntstcefvrtlnghkrgia
    clqyrdrlvvsgssdntirlwdiecgaclrvlegheelvrcirfdnkrivsgaydgkikv
    wdlvaaldprapagtlclrtlvehsgrvfrlqfdefqivssshddtiliwdflndpaaqa
    epprspsrtytyisr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p22A (A:)
    spaimlqrdfitalpargldhiaenilsyldakslcaaelvckewyrvtsdgmlwkklie
    rmvrtdslwrglaerrgwgqylfppnsfyralypkiiqdietiesnwrcgrhslqrihcr
    setskgvyclqyddqkivsglrdntikiwdkntleckriltghtgsvlclqyderviitg
    ssdstvrvwdvntgemlntlihhceavlhlrfnngmmvtcskdrsiavwdmasptditlr
    rvlvghraavnvvdfddkyivsasgdrtikvwntstcefvrtlnghkrgiaclqyrdrlv
    vsgssdntirlwdiecgaclrvlegheelvrcirfdnkrivsgaydgkikvwdlvaaldp
    rapagtlclrtlvehsgrvfrlqfdefqivssshddtiliwd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1p22B (B:)
    mpsiklqssdgeifevdveiakqsvtiktmledlgmdpvplpnvnaailkkviqwcthhk
    ddppddipvwdqeflkvdqgtlfelilaanyldikglldvtcktvanmikgktpeeirkt
    fnikndfteeeeaqvrkenqwceek
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p22B (B:)
    psiklqssdgeifevdveiakqsvtiktmledlgmdpvplpnvnaailkkviqwcthhip
    vwdqeflkvdqgtlfelilaanyldikglldvtcktvanmikgktpeeirktfnikndft
    eeeeaqvrken
    

  • Chain 'C':
    No sequence available.