PDB entry 1p1t

View 1p1t on RCSB PDB site
Description: NMR Structure of the N-terminal RRM domain of Cleavage stimulation factor 64 KDa subunit
Class: RNA binding protein
Keywords: RNA recognition motif, c-terminal helix, n-terminal helix, RNA binding protein
Deposited on 2003-04-14, released 2003-08-12
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cleavage stimulation factor, 64 kDa subunit
    Species: Homo sapiens [TaxId:9606]
    Gene: CSTF2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1p1ta_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1p1tA (A:)
    dpavdrslrsvfvgnipyeateeqlkdifsevgpvvsfrlvydretgkpkgygfceyqdq
    etalsamrnlngrefsgralrvdnaaseknkeelkslgtgapvi