PDB entry 1p1d

View 1p1d on RCSB PDB site
Description: Structural Insights into the Inter-domain Chaperoning of Tandem PDZ Domains in Glutamate Receptor Interacting Proteins
Class: protein binding
Keywords: PDZ domain, Glutamate Receptor, tandem repeats, scaffold protein, PROTEIN BINDING
Deposited on 2003-04-12, released 2003-11-11
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Glutamate receptor interacting protein
  Species: Rattus norvegicus [TaxId:10116]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P97879 (0-195)
  Domains in SCOPe 2.02: d1p1da1, d1p1da2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1p1dA (A:)
  qvvhtettevvltadpvtgfgiqlqgsvfatetlsspplisyieadspaercgvlqigdr
  vmaingiptedstfeeanqllrdssitskvtleiefdvaesvipssgtfhvklpkkhsve
  lgitisspssrkpgdplvisdikkgsvahrtgtlelgdkllaidnirldscsmedavqil
  qqcedlvklkirkded