PDB entry 1oyo

View 1oyo on RCSB PDB site
Description: Regulation of protease activity by melanin: Crystal structure of the complex formed between proteinase K and melanin monomers at 2.0 resolution
Class: Hydrolase
Keywords: Proteinase K, Activity, Inhibition, Melanin, Hydrolase
Deposited on 2003-04-06, released 2003-05-20
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.02 Å
R-factor: 0.171
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Proteinase K
    Species: Engyodontium album [TaxId:37998]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1oyoa_
  • Heterogens: CA, 3ID, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1oyoA (A:)
    aaqtnapwglarisstspgtstyyydesagqgscvyvidtgieashpefegraqmvktyy
    yssrdgnghgthcagtvgsrtygvakktqlfgvkvlddngsgqystiiagmdfvasdknn
    rncpkgvvaslslgggysssvnsaaarlqssgvmvavaagnnnadarnyspasepsvctv
    gasdrydrrssfsnygsvldifgpgtsilstwiggstrsisgtsmatphvaglaaylmtl
    gkttaasacryiadtankgdlsnipfgtvnllaynnyqa