PDB entry 1ouz

View 1ouz on RCSB PDB site
Description: Crystal structure of a mutant IHF (BetaE44A) complexed with a variant H' Site (T44A)
Class: transcription/DNA
Keywords: protein-DNA recognition, indirect readout, IHF, DNA bending, TRANSCRIPTION/DNA COMPLEX
Deposited on 2003-03-25, released 2003-07-15
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.41 Å
R-factor: 0.241
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Integration host factor alpha-subunit
  Species: Escherichia coli [TaxId:562]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0A6X7
  Domains in SCOPe 2.04: d1ouza_
• Chain 'B':
  Compound: Integration host factor beta-subunit
  Species: Escherichia coli [TaxId:562]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0A6Y1 (0-93)
    • engineered (43)
  Domains in SCOPe 2.04: d1ouzb_
• Chain 'C':
  Compound: Phage lambda H' site
  
• Chain 'D':
  Compound: 5'-d(*gp*gp*cp*cp*ap*ap*ap*ap*ap*ap*gp*cp*ap*tp*t)-3'
  
• Chain 'E':
  Compound: 5'-d(*gp*cp*tp*tp*ap*tp*cp*ap*ap*tp*tp*tp*gp*tp*ap*gp*cp*ap*cp*c)-3'
  
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >1ouzA (A:)
  maltkaemseylfdklglskrdakelvelffeeirralengeqvklsgfgnfdlrdknqr
  pgrnpktgedipitarrvvtfrpgqklksrvenaspkde
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >1ouzA (A:)
  altkaemseylfdklglskrdakelvelffeeirralengeqvklsgfgnfdlrdknqrp
  grnpktgedipitarrvvtfrpgqklksrvenaspk
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ouzB (B:)
  mtkselierlatqqshipaktvedavkemlehmastlaqgeriairgfgsfslhyraprt
  grnpktgdkvelegkyvphfkpgkelrdraniyg
  

  
  
• Chain 'C':
  No sequence available.
  
  
• Chain 'D':
  No sequence available.
  
  
• Chain 'E':
  No sequence available.