PDB entry 1ou8

View 1ou8 on RCSB PDB site
Description: structure of an AAA+ protease delivery protein in complex with a peptide degradation tag
Class: transport protein
Keywords: peptide-binding pocket, protein-peptide complex, homodimer, TRANSPORT PROTEIN
Deposited on 2003-03-24, released 2003-09-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.206
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Stringent starvation protein B homolog
    Species: Haemophilus influenzae [TaxId:727]
    Gene: SSPB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ou8a_
  • Chain 'B':
    Compound: Stringent starvation protein B homolog
    Species: Haemophilus influenzae [TaxId:727]
    Gene: SSPB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ou8b_
  • Chain 'C':
    Compound: synthetic ssrA peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1OU8 (0-10)
  • Chain 'D':
    Compound: synthetic ssrA peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1OU8 (Start-10)
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1ou8A (A:)
meyksspkrpyllrayydwlvdnsftpylvvdatylgvnvpveyvkdgqivlnlsasatg
nlqltndfiqfnarfkgvsrelyipmgaalaiyarengdgvmfepeeiyde

    Sequence, based on observed residues (ATOM records): (download) 
    >1ou8A (A:)
sspkrpyllrayydwlvdnsftpylvvdatylgvnvpveyvkdgqivlnlsasatgnlql
tndfiqfnarfkgvsrelyipmgaalaiyarengdgvmfepeeiyd

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >1ou8B (B:)
meyksspkrpyllrayydwlvdnsftpylvvdatylgvnvpveyvkdgqivlnlsasatg
nlqltndfiqfnarfkgvsrelyipmgaalaiyarengdgvmfepeeiyde

    Sequence, based on observed residues (ATOM records): (download) 
    >1ou8B (B:)
sspkrpyllrayydwlvdnsftpylvvdatylgvnvpveyvkdgqivlnlsasatgnlql
tndfiqfnarfkgvsrelyipmgaalaiyarengdgvmfepeeiyd

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.