PDB entry 1osv

View 1osv on RCSB PDB site
Description: structural basis for bile acid binding and activation of the nuclear receptor fxr
Class: DNA binding protein
Keywords: LBD, bile acid, coactivator, nuclear receptor, DNA BINDING PROTEIN
Deposited on 2003-03-20, released 2004-03-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.242
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bile acid receptor
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q62735 (1-End)
      • cloning artifact (0)
    Domains in SCOPe 2.07: d1osva1, d1osva2
  • Chain 'B':
    Compound: Bile acid receptor
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q62735 (1-End)
      • cloning artifact (0)
    Domains in SCOPe 2.07: d1osvb1, d1osvb2
  • Chain 'C':
    Compound: nuclear receptor coactivator 2
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: nuclear receptor coactivator 2
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: nuclear receptor coactivator 2
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Heterogens: CHC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1osvA (A:)
    aeltvdqqtlldyimdsyskqrmpqeitnkilkeefsaeenfliltematshvqilveft
    krlpgfqtldhedqiallkgsaveamflrsaeifnkklpaghadlleerirksgisdeyi
    tpmfsfyksvgelkmtqeeyalltaivilspdrqyikdreaveklqeplldvlqklckiy
    qpenpqhfacllgrltelrtfnhhhaemlmswrvndhkftpllceiwdvq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1osvA (A:)
    aeltvdqqtlldyimdsyskqrmpqeitnkilkeefsaeenfliltematshvqilveft
    krlpgfqtldhedqiallkgsaveamflrsaeifnkklpaghadlleerirksgisdeyi
    tpmfsfyksvgelkmtqeeyalltaivilspdrqyikdreaveklqeplldvlqklckiy
    qpenpqhfacllgrltelrtfnhhhaemlmswrvndhkftpllceiwdv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1osvB (B:)
    aeltvdqqtlldyimdsyskqrmpqeitnkilkeefsaeenfliltematshvqilveft
    krlpgfqtldhedqiallkgsaveamflrsaeifnkklpaghadlleerirksgisdeyi
    tpmfsfyksvgelkmtqeeyalltaivilspdrqyikdreaveklqeplldvlqklckiy
    qpenpqhfacllgrltelrtfnhhhaemlmswrvndhkftpllceiwdvq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1osvB (B:)
    aeltvdqqtlldyimdsyskqrmpqeitnkilkeefsaeenfliltematshvqilveft
    krlpgfqtldhedqiallkgsaveamflrsaeifnkklpaghadlleerirksgisdeyi
    tpmfsfyksvgelkmtqeeyalltaivilspdrqyikdreaveklqeplldvlqklckiy
    qpenpqhfacllgrltelrtfnhhhaemlmswrvndhkftpllceiwdv
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.