SCOPe 2.08: Domain d1osvb1: 1osv B:241-468

Lineage for d1osvb1 (1osv B:241-468)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
   multihelical; 3 layers or orthogonally packed helices

4. Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families)

5. Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)

6. Protein Bile acid receptor FXR [101433] (2 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [101435] (2 PDB entries)

8. Domain d1osvb1: 1osv B:241-468 [93501]
   Other proteins in same PDB: d1osva2, d1osvb2
   complexed with a co-activator peptide, chains C, D and E
   complexed with chc

Details for d1osvb1

PDB Entry: 1osv, 2.5 Å

PDB Description: structural basis for bile acid binding and activation of the nuclear receptor fxr

PDB Compounds: (B:) Bile acid receptor

SCOPe Domain Sequences for d1osvb1:

Sequence; same for both SEQRES and ATOM records:

>d1osvb1 a.123.1.1 (B:241-468) Bile acid receptor FXR {Norway rat (Rattus norvegicus) [TaxId: 10116]}
eltvdqqtlldyimdsyskqrmpqeitnkilkeefsaeenfliltematshvqilveftk
rlpgfqtldhedqiallkgsaveamflrsaeifnkklpaghadlleerirksgisdeyit
pmfsfyksvgelkmtqeeyalltaivilspdrqyikdreaveklqeplldvlqklckiyq
penpqhfacllgrltelrtfnhhhaemlmswrvndhkftpllceiwdv

Timeline for d1osvb1:

• d1osvb1 first appeared in SCOP 1.67, called d1osvb_
  
• d1osvb1 appears in SCOPe 2.07