PDB entry 1osl

View 1osl on RCSB PDB site
Description: Solution structure of a dimeric lactose DNA-binding domain complexed to a nonspecific DNA sequence
Class: transcription/DNA
Keywords: Protein-DNA complex, Lac repressor, nonspecific interaction, TRANSCRIPTION/DNA COMPLEX
Deposited on 2003-03-20, released 2004-05-04
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lactose operon repressor
    Species: Escherichia coli [TaxId:562]
    Gene: lacI
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03023 (0-61)
      • engineered (51)
    Domains in SCOPe 2.04: d1osla_
  • Chain 'B':
    Compound: lactose operon repressor
    Species: Escherichia coli [TaxId:562]
    Gene: lacI
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03023 (0-61)
      • engineered (51)
    Domains in SCOPe 2.04: d1oslb_
  • Chain 'C':
    Compound: 5'-d(*cp*gp*ap*tp*ap*ap*gp*ap*tp*ap*tp*cp*tp*tp*ap*tp*cp*g)-3'
  • Chain 'D':
    Compound: 5'-d(*cp*gp*ap*tp*ap*ap*gp*ap*tp*ap*tp*cp*tp*tp*ap*tp*cp*g)-3'

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1oslA (A:)
    mkpvtlydvaeyagvsyqtvsrvvnqashvsaktrekveaamaelnyipnrcaqqlagkq
    sl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1oslB (B:)
    mkpvtlydvaeyagvsyqtvsrvvnqashvsaktrekveaamaelnyipnrcaqqlagkq
    sl
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.