PDB entry 1org

View 1org on RCSB PDB site
Description: The crystal structure of a pheromone binding protein from the cockroach Leucophaea maderae reveals a new mechanism of pheromone binding
Class: transport protein
Keywords: Pheromone binding Protein, APO-FORM, 6 ALPHA HELIX, Transport protein
Deposited on 2003-03-13, released 2003-08-05
The last revision prior to the SCOP 1.75 freeze date was dated 2003-08-19, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.184
AEROSPACI score: 0.66 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pheromone binding protein
    Species: Leucophaea maderae
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1orga_
  • Chain 'B':
    Compound: pheromone binding protein
    Species: Leucophaea maderae
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1orgb_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1orgA (A:)
stqsykdamgplvrecmgsvsateddfktvlnrnplesrtaqcllacaldkvglispega
iytgddlmpvmnrlygfndfktvmkakavndcanqvngaypdrcdliknftdcvrnsy

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1orgB (B:)
stqsykdamgplvrecmgsvsateddfktvlnrnplesrtaqcllacaldkvglispega
iytgddlmpvmnrlygfndfktvmkakavndcanqvngaypdrcdliknftdcvrnsy