Lineage for d1orga_ (1org A:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 768455Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 769304Superfamily a.39.2: Insect pheromone/odorant-binding proteins [47565] (1 family) (S)
    the N-terminal extension, containing a few short helices, forms a flexible lid for the binding cavity
  5. 769305Family a.39.2.1: Insect pheromone/odorant-binding proteins [47566] (5 proteins)
  6. 769333Protein Pheromone binding protein PBPLma [101188] (1 species)
  7. 769334Species Madeira cockroach (Leucophaea maderae) [TaxId:36963] [101189] (3 PDB entries)
  8. 769339Domain d1orga_: 1org A: [93453]

Details for d1orga_

PDB Entry: 1org (more details), 1.7 Å

PDB Description: The crystal structure of a pheromone binding protein from the cockroach Leucophaea maderae reveals a new mechanism of pheromone binding
PDB Compounds: (A:) pheromone binding protein

SCOP Domain Sequences for d1orga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1orga_ a.39.2.1 (A:) Pheromone binding protein PBPLma {Madeira cockroach (Leucophaea maderae) [TaxId: 36963]}
stqsykdamgplvrecmgsvsateddfktvlnrnplesrtaqcllacaldkvglispega
iytgddlmpvmnrlygfndfktvmkakavndcanqvngaypdrcdliknftdcvrnsy

SCOP Domain Coordinates for d1orga_:

Click to download the PDB-style file with coordinates for d1orga_.
(The format of our PDB-style files is described here.)

Timeline for d1orga_: