PDB entry 1oqa

View 1oqa on RCSB PDB site
Description: Solution structure of the BRCT-c domain from human BRCA1
Class: gene regulation
Keywords: BRCT, breast cancer, GENE REGULATION
Deposited on 2003-03-07, released 2004-06-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: breast cancer type 1 susceptibility protein
  Species: Homo sapiens [TaxId:9606]
  Gene: BRCA1
  Database cross-references and differences (RAF-indexed):
  • Uniprot P38398 (1-109)
    • cloning artifact (0)
  Domains in SCOPe 2.06: d1oqaa1, d1oqaa2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1oqaA (A:)
  gsqdrkifrgleiccygpftnmptdqlewmvqlcgasvvkelssftlgtgvhpivvvqpd
  awtedngfhaigqmceapvvtrewvldsvalyqcqeldtylipqiphshy