PDB entry 1opd

View 1opd on RCSB PDB site
Description: histidine-containing protein (hpr), mutant with ser 46 replaced by asp (s46d)
Class: phosphotransferase
Keywords: phosphotransferase, histidine
Deposited on 1996-08-01, released 1997-08-20
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.182
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: histidine-containing protein
  Species: Escherichia coli [TaxId:562]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0AA04 (0-84)
    • conflict (2)
    • engineered (45)
  Domains in SCOPe 2.06: d1opda_
• Heterogens: SO4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1opdA (A:)
  mfeqevtitapnglhtrpaaqfvkeakgftseitvtsngksasakdlfklqtlgltqgtv
  vtisaegedeqkavehlvklmaele