PDB entry 1op1

View 1op1 on RCSB PDB site
Description: Solution NMR structure of domain 1 of receptor associated protein
Class: Receptor Associated Protein
Keywords: helical bundle, Receptor Associated Protein
Deposited on 2003-03-04, released 2003-08-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-02-08, with a file datestamp of 2017-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Alpha-2-macroglobulin receptor-associated protein precursor
    Species: Homo sapiens [TaxId:9606]
    Gene: LRPAP1 OR A2MRAP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1op1a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1op1A (A:)
geefrmeklnqlwekaqrlhlppvrlaelhadlkiqerdelawkklkldgldedgekear
lirnlnvilakygldgkkdarq