PDB entry 1ooi

View 1ooi on RCSB PDB site
Description: Crystal structure of LUSH from Drosophila melanogaster at pH 6.5
Class: transport protein
Keywords: LUSH, Alcohol, Odorant-Binding Protein, TRANSPORT PROTEIN
Deposited on 2003-03-03, released 2003-09-02
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.04 Å
R-factor: 0.201
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Compound: odorant binding protein LUSH
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: lush
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ooix_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'X':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1ooiX (X:)
mtmeqfltsldmirsgcapkfklktedldrlrvgdfnfppsqdlmcytkcvslmagtvnk
kgefnapkalaqlphlvppemmemsrksveacrdthkqfkescervyqtakcfsenadgq
fmwp