PDB entry 1on3

View 1on3 on RCSB PDB site
Description: Transcarboxylase 12S crystal structure: hexamer assembly and substrate binding to a multienzyme core (with methylmalonyl-coenzyme a and methylmalonic acid bound)
Class: transferase
Keywords: carboxyl transferase, crystal structure, domain duplication, multienzyme complex, transcarboxylase
Deposited on 2003-02-26, released 2003-05-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.168
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Methylmalonyl-CoA carboxyltransferase 12S subunit
    Species: Propionibacterium freudenreichii [TaxId:1744]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1on3a1, d1on3a2
  • Chain 'B':
    Compound: Methylmalonyl-CoA carboxyltransferase 12S subunit
    Species: Propionibacterium freudenreichii [TaxId:1744]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1on3b1, d1on3b2
  • Chain 'C':
    Compound: Methylmalonyl-CoA carboxyltransferase 12S subunit
    Species: Propionibacterium freudenreichii [TaxId:1744]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1on3c1, d1on3c2
  • Chain 'D':
    Compound: Methylmalonyl-CoA carboxyltransferase 12S subunit
    Species: Propionibacterium freudenreichii [TaxId:1744]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1on3d1, d1on3d2
  • Chain 'E':
    Compound: Methylmalonyl-CoA carboxyltransferase 12S subunit
    Species: Propionibacterium freudenreichii [TaxId:1744]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1on3e1, d1on3e2
  • Chain 'F':
    Compound: Methylmalonyl-CoA carboxyltransferase 12S subunit
    Species: Propionibacterium freudenreichii [TaxId:1744]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1on3f1, d1on3f2
  • Heterogens: CD, MCA, DXX, MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1on3A (A:)
    aennnlklastmegrveqlaeqrqvieagggerrvekqhsqgkqtarerlnnlldphsfd
    evgafrkhrttlfgmdkavvpadgvvtgrgtilgrpvhaasqdftvmggsagetqstkvv
    etmeqalltgtpflffydsggariqegidslsgygkmffanvklsgvvpqiaiiagpcag
    gasyspaltdfiimtkkahmfitgpqviksvtgedvtadelggaeahmaisgnihfvaed
    ddaaeliakkllsflpqnnteeasfvnpnndvspntelrdivpidgkkgydvrdviakiv
    dwgdylevkagyatnlvtafarvngrsvgivanqpsvmsgcldinasdkaaefvnfcdsf
    niplvqlvdvpgflpgvqqeyggiirhgakmlyayseatvpkitvvlrkayggsylamcn
    rdlgadavyawpsaeiavmgaegaanvifrkeikaaddpdamraekieeyqnafntpyva
    aargqvddvidpadtrrkiasalemyatkrqtrpakkhgnfpc
    

    Sequence, based on observed residues (ATOM records): (download)
    >1on3A (A:)
    klastmegrveqlaeqrqvieagggerrvekqhsqgkqtarerlnnlldphsfdevgafr
    khrttlfgmdkavvpadgvvtgrgtilgrpvhaasqdftvmggsagetqstkvvetmeqa
    lltgtpflffydsggariqegidslsgygkmffanvklsgvvpqiaiiagpcaggasysp
    altdfiimtkkahmfitgpqviksvtgedvtadelggaeahmaisgnihfvaedddaael
    iakkllsflpqnnteeasfvnpnndvspntelrdivpidgkkgydvrdviakivdwgdyl
    evkagyatnlvtafarvngrsvgivanqpsvmsgcldinasdkaaefvnfcdsfniplvq
    lvdvpgflpgvqqeyggiirhgakmlyayseatvpkitvvlrkayggsylamcnrdlgad
    avyawpsaeiavmgaegaanvifrkeikaaddpdamraekieeyqnafntpyvaaargqv
    ddvidpadtrrkiasalemyatkrqtrpakkhgnfpc
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1on3B (B:)
    aennnlklastmegrveqlaeqrqvieagggerrvekqhsqgkqtarerlnnlldphsfd
    evgafrkhrttlfgmdkavvpadgvvtgrgtilgrpvhaasqdftvmggsagetqstkvv
    etmeqalltgtpflffydsggariqegidslsgygkmffanvklsgvvpqiaiiagpcag
    gasyspaltdfiimtkkahmfitgpqviksvtgedvtadelggaeahmaisgnihfvaed
    ddaaeliakkllsflpqnnteeasfvnpnndvspntelrdivpidgkkgydvrdviakiv
    dwgdylevkagyatnlvtafarvngrsvgivanqpsvmsgcldinasdkaaefvnfcdsf
    niplvqlvdvpgflpgvqqeyggiirhgakmlyayseatvpkitvvlrkayggsylamcn
    rdlgadavyawpsaeiavmgaegaanvifrkeikaaddpdamraekieeyqnafntpyva
    aargqvddvidpadtrrkiasalemyatkrqtrpakkhgnfpc
    

    Sequence, based on observed residues (ATOM records): (download)
    >1on3B (B:)
    lastmegrveqlaeqrqvieagggerrvekqhsqgkqtarerlnnlldphsfdevgafrk
    hrttlfgmdkavvpadgvvtgrgtilgrpvhaasqdftvmggsagetqstkvvetmeqal
    ltgtpflffydsggariqegidslsgygkmffanvklsgvvpqiaiiagpcaggasyspa
    ltdfiimtkkahmfitgpqviksvtgedvtadelggaeahmaisgnihfvaedddaaeli
    akkllsflpqnnteeasfvnpnndvspntelrdivpidgkkgydvrdviakivdwgdyle
    vkagyatnlvtafarvngrsvgivanqpsvmsgcldinasdkaaefvnfcdsfniplvql
    vdvpgflpgvqqeyggiirhgakmlyayseatvpkitvvlrkayggsylamcnrdlgada
    vyawpsaeiavmgaegaanvifrkeikaaddpdamraekieeyqnafntpyvaaargqvd
    dvidpadtrrkiasalemyatkrqtrpakkhgnfpc
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1on3C (C:)
    aennnlklastmegrveqlaeqrqvieagggerrvekqhsqgkqtarerlnnlldphsfd
    evgafrkhrttlfgmdkavvpadgvvtgrgtilgrpvhaasqdftvmggsagetqstkvv
    etmeqalltgtpflffydsggariqegidslsgygkmffanvklsgvvpqiaiiagpcag
    gasyspaltdfiimtkkahmfitgpqviksvtgedvtadelggaeahmaisgnihfvaed
    ddaaeliakkllsflpqnnteeasfvnpnndvspntelrdivpidgkkgydvrdviakiv
    dwgdylevkagyatnlvtafarvngrsvgivanqpsvmsgcldinasdkaaefvnfcdsf
    niplvqlvdvpgflpgvqqeyggiirhgakmlyayseatvpkitvvlrkayggsylamcn
    rdlgadavyawpsaeiavmgaegaanvifrkeikaaddpdamraekieeyqnafntpyva
    aargqvddvidpadtrrkiasalemyatkrqtrpakkhgnfpc
    

    Sequence, based on observed residues (ATOM records): (download)
    >1on3C (C:)
    lastmegrveqlaeqrqvieagggerrvekqhsqgkqtarerlnnlldphsfdevgafrk
    hrttlfgmdkavvpadgvvtgrgtilgrpvhaasqdftvmggsagetqstkvvetmeqal
    ltgtpflffydsggariqegidslsgygkmffanvklsgvvpqiaiiagpcaggasyspa
    ltdfiimtkkahmfitgpqviksvtgedvtadelggaeahmaisgnihfvaedddaaeli
    akkllsflpqnnteeasfvnpnndvspntelrdivpidgkkgydvrdviakivdwgdyle
    vkagyatnlvtafarvngrsvgivanqpsvmsgcldinasdkaaefvnfcdsfniplvql
    vdvpgflpgvqqeyggiirhgakmlyayseatvpkitvvlrkayggsylamcnrdlgada
    vyawpsaeiavmgaegaanvifrkepdamraekieeyqnafntpyvaaargqvddvidpa
    dtrrkiasalemyatkrqtrpakkhgnfpc
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1on3D (D:)
    aennnlklastmegrveqlaeqrqvieagggerrvekqhsqgkqtarerlnnlldphsfd
    evgafrkhrttlfgmdkavvpadgvvtgrgtilgrpvhaasqdftvmggsagetqstkvv
    etmeqalltgtpflffydsggariqegidslsgygkmffanvklsgvvpqiaiiagpcag
    gasyspaltdfiimtkkahmfitgpqviksvtgedvtadelggaeahmaisgnihfvaed
    ddaaeliakkllsflpqnnteeasfvnpnndvspntelrdivpidgkkgydvrdviakiv
    dwgdylevkagyatnlvtafarvngrsvgivanqpsvmsgcldinasdkaaefvnfcdsf
    niplvqlvdvpgflpgvqqeyggiirhgakmlyayseatvpkitvvlrkayggsylamcn
    rdlgadavyawpsaeiavmgaegaanvifrkeikaaddpdamraekieeyqnafntpyva
    aargqvddvidpadtrrkiasalemyatkrqtrpakkhgnfpc
    

    Sequence, based on observed residues (ATOM records): (download)
    >1on3D (D:)
    lklastmegrveqlaeqrqvieagggerrvekqhsqgkqtarerlnnlldphsfdevgaf
    rkhrttlfgmdkavvpadgvvtgrgtilgrpvhaasqdftvmggsagetqstkvvetmeq
    alltgtpflffydsggariqegidslsgygkmffanvklsgvvpqiaiiagpcaggasys
    paltdfiimtkkahmfitgpqviksvtgedvtadelggaeahmaisgnihfvaedddaae
    liakkllsflpqnnteeasfvnpnndvspntelrdivpidgkkgydvrdviakivdwgdy
    levkagyatnlvtafarvngrsvgivanqpsvmsgcldinasdkaaefvnfcdsfniplv
    qlvdvpgflpgvqqeyggiirhgakmlyayseatvpkitvvlrkayggsylamcnrdlga
    davyawpsaeiavmgaegaanvifrkeikdamraekieeyqnafntpyvaaargqvddvi
    dpadtrrkiasalemyatkrqtrpakkhgnfpc
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1on3E (E:)
    aennnlklastmegrveqlaeqrqvieagggerrvekqhsqgkqtarerlnnlldphsfd
    evgafrkhrttlfgmdkavvpadgvvtgrgtilgrpvhaasqdftvmggsagetqstkvv
    etmeqalltgtpflffydsggariqegidslsgygkmffanvklsgvvpqiaiiagpcag
    gasyspaltdfiimtkkahmfitgpqviksvtgedvtadelggaeahmaisgnihfvaed
    ddaaeliakkllsflpqnnteeasfvnpnndvspntelrdivpidgkkgydvrdviakiv
    dwgdylevkagyatnlvtafarvngrsvgivanqpsvmsgcldinasdkaaefvnfcdsf
    niplvqlvdvpgflpgvqqeyggiirhgakmlyayseatvpkitvvlrkayggsylamcn
    rdlgadavyawpsaeiavmgaegaanvifrkeikaaddpdamraekieeyqnafntpyva
    aargqvddvidpadtrrkiasalemyatkrqtrpakkhgnfpc
    

    Sequence, based on observed residues (ATOM records): (download)
    >1on3E (E:)
    nnlklastmegrveqlaeqrqvieagggerrvekqhsqgkqtarerlnnlldphsfdevg
    afrkhrttlfgmdkavvpadgvvtgrgtilgrpvhaasqdftvmggsagetqstkvvetm
    eqalltgtpflffydsggariqegidslsgygkmffanvklsgvvpqiaiiagpcaggas
    yspaltdfiimtkkahmfitgpqviksvtgedvtadelggaeahmaisgnihfvaeddda
    aeliakkllsflpqnnteeasfvnpnndvspntelrdivpidgkkgydvrdviakivdwg
    dylevkagyatnlvtafarvngrsvgivanqpsvmsgcldinasdkaaefvnfcdsfnip
    lvqlvdvpgflpgvqqeyggiirhgakmlyayseatvpkitvvlrkayggsylamcnrdl
    gadavyawpsaeiavmgaegaanvifrkeikaaddpdamraekieeyqnafntpyvaaar
    gqvddvidpadtrrkiasalemyatkrqtrpakkhgnfpc
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1on3F (F:)
    aennnlklastmegrveqlaeqrqvieagggerrvekqhsqgkqtarerlnnlldphsfd
    evgafrkhrttlfgmdkavvpadgvvtgrgtilgrpvhaasqdftvmggsagetqstkvv
    etmeqalltgtpflffydsggariqegidslsgygkmffanvklsgvvpqiaiiagpcag
    gasyspaltdfiimtkkahmfitgpqviksvtgedvtadelggaeahmaisgnihfvaed
    ddaaeliakkllsflpqnnteeasfvnpnndvspntelrdivpidgkkgydvrdviakiv
    dwgdylevkagyatnlvtafarvngrsvgivanqpsvmsgcldinasdkaaefvnfcdsf
    niplvqlvdvpgflpgvqqeyggiirhgakmlyayseatvpkitvvlrkayggsylamcn
    rdlgadavyawpsaeiavmgaegaanvifrkeikaaddpdamraekieeyqnafntpyva
    aargqvddvidpadtrrkiasalemyatkrqtrpakkhgnfpc
    

    Sequence, based on observed residues (ATOM records): (download)
    >1on3F (F:)
    klastmegrveqlaeqrqvieagggerrvekqhsqgkqtarerlnnlldphsfdevgafr
    khrttlfgmdkavvpadgvvtgrgtilgrpvhaasqdftvmggsagetqstkvvetmeqa
    lltgtpflffydsggariqegidslsgygkmffanvklsgvvpqiaiiagpcaggasysp
    altdfiimtkkahmfitgpqviksvtgedvtadelggaeahmaisgnihfvaedddaael
    iakkllsflpqnnteeasfvnpnndvspntelrdivpidgkkgydvrdviakivdwgdyl
    evkagyatnlvtafarvngrsvgivanqpsvmsgcldinasdkaaefvnfcdsfniplvq
    lvdvpgflpgvqqeyggiirhgakmlyayseatvpkitvvlrkayggsylamcnrdlgad
    avyawpsaeiavmgaegaanvifrkeikaaddpdamraekieeyqnafntpyvaaargqv
    ddvidpadtrrkiasalemyatkrqtrpakkhgnfpc