Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.14: ClpP/crotonase [52095] (1 superfamily) core: 4 turns of (beta-beta-alpha)n superhelix |
Superfamily c.14.1: ClpP/crotonase [52096] (5 families) |
Family c.14.1.4: Biotin dependent carboxylase carboxyltransferase domain [89572] (9 proteins) Pfam PF01039 the active site is formed by two different homologous subunits or domains of this fold |
Protein Methylmalonyl-CoA carboxyltransferase (transcarboxylase 12S) [89575] (1 species) |
Species Propionibacterium freudenreichii [TaxId:1744] [89576] (2 PDB entries) |
Domain d1on3b2: 1on3 B:261-524 [87110] complexed with cd, dxx, mca, mpd has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1on3 (more details), 1.9 Å
SCOPe Domain Sequences for d1on3b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1on3b2 c.14.1.4 (B:261-524) Methylmalonyl-CoA carboxyltransferase (transcarboxylase 12S) {Propionibacterium freudenreichii [TaxId: 1744]} teeasfvnpnndvspntelrdivpidgkkgydvrdviakivdwgdylevkagyatnlvta farvngrsvgivanqpsvmsgcldinasdkaaefvnfcdsfniplvqlvdvpgflpgvqq eyggiirhgakmlyayseatvpkitvvlrkayggsylamcnrdlgadavyawpsaeiavm gaegaanvifrkeikaaddpdamraekieeyqnafntpyvaaargqvddvidpadtrrki asalemyatkrqtrpakkhgnfpc
Timeline for d1on3b2: