PDB entry 1omy

View 1omy on RCSB PDB site
Description: Crystal Structure of a Recombinant alpha-insect Toxin BmKaIT1 from the scorpion Buthus martensii Karsch
Class: Toxin
Keywords: alpha-insect toxin, sodium channel
Deposited on 2003-02-26, released 2003-09-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.185
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Alpha-neurotoxin TX12
    Species: Mesobuthus martensii [TaxId:34649]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1omya_
  • Heterogens: CL, ACY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1omyA (A:)
mvrdayiaqnyncvyhcardaycnelctkngaksgscpylgehkfacyckdlpdnvpirv
pgkch

    Sequence, based on observed residues (ATOM records): (download) 
    >1omyA (A:)
vrdayiaqnyncvyhcardaycnelctkngaksgscpylgehkfacyckdlpdnvpirvp
gkch