PDB entry 1oh1

View 1oh1 on RCSB PDB site
Description: solution structure of staphostatin a form staphylococcus aureus confirms the discovery of a novel class of cysteine proteinase inhibitors.
Class: cysteine proteinase inhibitor
Keywords: cysteine proteinase inhibitor, cysteine protease inhibitor, staphopain inhibitor, not similar to cystatins
Deposited on 2003-05-21, released 2003-11-20
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: staphostatin a
    Species: STAPHYLOCOCCUS AUREUS [TaxId:1280]
    Database cross-references and differences (RAF-indexed):
    • PDB 1OH1 (0-1)
    • Uniprot Q99SX7 (2-108)
    Domains in SCOPe 2.04: d1oh1a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1oh1A (A:)
gsmeqfelfsidkfkcnseakyylniiegewhpqdlndsplkfilstsddsdyickyint
ehkqltlynknnssivieifipndnkilltimntealgtsprmtfikhk