PDB entry 1ofv

View 1ofv on RCSB PDB site
Description: flavodoxin from anacystis nidulans: refinement of two forms of the oxidized protein
Deposited on 1992-06-22, released 1994-01-31
The last revision prior to the SCOP 1.61 freeze date was dated 1994-01-31, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 1.7 Å
R-factor: 0.19
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.61: d1ofv__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ofv_ (-)
    akiglfygtqtgvtqtiaesiqqefggesivdlndianadasdlnaydyliigcptwnvg
    elqsdwegiyddldsvnfqgkkvayfgagdqvgysdnfqdamgileekisslgsqtvgyw
    piegydfneskavrnnqfvglaidednqpdltknriktwvsqlksefgl