PDB entry 1o6g

View 1o6g on RCSB PDB site
Description: prolyl oligopeptidase from porcine brain, d641n mutant with bound peptide ligand suc-gly-pro
Class: hydrolase
Keywords: hydrolase, prolyl oligopeptidase, amnesia, alpha/ beta-hydrolase, beta-propeller
Deposited on 2002-09-15, released 2002-11-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.2
AEROSPACI score: 0.66 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: prolyl endopeptidase
    Species: SUS SCROFA, synthetic [TaxId:9823]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P23687 (0-709)
      • engineered mutation (225)
      • engineered mutation (640)
    Domains in SCOPe 2.07: d1o6ga1, d1o6ga2
  • Heterogens: GLY, PRO, SIN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1o6gA (A:)
    mlsfqypdvyrdetaiqdyhghkvcdpyawledpdseqtkafveaqnkitvpfleqcpir
    glykermtelydypkyschfkkgkryfyfyntglqnqrvlyvqdslegearvfldpnils
    ddgtvalrgyafsedgeyfayglsasgsdwvtikfmkvdgakelpdvlervkfscmawth
    dgkgmfynaypqqdgksdgtetstnlhqklyyhvlgtdqsedilcvefpdepkwmggael
    sddgryvllsiregcdpvnrlwycdlqqesngitgilkwvklidnfegeydyvtnegtvf
    tfktnrhspnyrlinidftdpeeskwkvlvpehekdvlewvacvrsnflvlcylhdvknt
    lqlhdlatgallkifplevgsvvgysgqkkdteifyqftsflspgiiyhcdltkeelepr
    vfrevtvkgidasdyqtvqifypskdgtkipmfivhkkgikldgshpaflygyggfnisi
    tpnysvsrlifvrhmggvlavanirgggeygetwhkggilankqncfddfqcaaeylike
    gytspkrltinggsnggllvatcanqrpdlfgcviaqvgvmdmlkfhkytighawttdyg
    csdskqhfewlikysplhnvklpeaddiqypsmllltadhndrvvplhslkfiatlqyiv
    grsrkqnnpllihvdtkaghgagkptakvieevsdmfafiarclnidwip