Lineage for d1o6ga1 (1o6g A:1-430)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
consists of seven 4-stranded beta-sheet motifs; meander
Superfamily b.69.7: Peptidase/esterase 'gauge' domain [50993] (3 families) 
Family b.69.7.1: Prolyl oligopeptidase, N-terminal domain [50994] (2 proteins)
automatically mapped to Pfam PF02897Protein Prolyl oligopeptidase, N-terminal domain [50995] (3 species) Species Pig (Sus scrofa) [TaxId:9823] [50996] (27 PDB entries)
Uniprot P23687
Domain d1o6ga1: 1o6g A:1-430 [81087]
Other proteins in same PDB: d1o6ga2
complexed with gly, pro, sin; mutant
Details for d1o6ga1
PDB Entry: 1o6g (more details), 1.4 Å
PDB Description: prolyl oligopeptidase from porcine brain, d641n mutant with bound peptide ligand suc-gly-pro
PDB Compounds: (A:) prolyl endopeptidaseSCOPe Domain Sequences for d1o6ga1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1o6ga1 b.69.7.1 (A:1-430) Prolyl oligopeptidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}
mlsfqypdvyrdetaiqdyhghkvcdpyawledpdseqtkafveaqnkitvpfleqcpir
glykermtelydypkyschfkkgkryfyfyntglqnqrvlyvqdslegearvfldpnils
ddgtvalrgyafsedgeyfayglsasgsdwvtikfmkvdgakelpdvlervkfscmawth
dgkgmfynaypqqdgksdgtetstnlhqklyyhvlgtdqsedilcvefpdepkwmggael
sddgryvllsiregcdpvnrlwycdlqqesngitgilkwvklidnfegeydyvtnegtvf
tfktnrhspnyrlinidftdpeeskwkvlvpehekdvlewvacvrsnflvlcylhdvknt
lqlhdlatgallkifplevgsvvgysgqkkdteifyqftsflspgiiyhcdltkeelepr
vfrevtvkgi
SCOPe Domain Coordinates for d1o6ga1:
Click to download the PDB-style file with coordinates for d1o6ga1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1o6ga1:
- d1o6ga1 first appeared in SCOP 1.63
- d1o6ga1 appears in SCOPe 2.07
View in 3D
