PDB entry 1ny9

View 1ny9 on RCSB PDB site
Description: Antibiotic binding domain of a TipA-class multidrug resistance transcriptional regulator
Class: transcription
Keywords: all alpha, globin like, TRANSCRIPTION
Deposited on 2003-02-12, released 2003-04-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transcriptional activator tipA-S
    Species: Streptomyces lividans [TaxId:1916]
    Gene: tipA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ny9a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1ny9A (A:)
ginltpeekfevfgdfdpdqyeeevrerwgntdayrqskektasytkedwqriqdeadel
trrfvalmdagepadsegamdaaedhrqgiarnhydcgyemhtclgemyvsderftrnid
aakpglaaymrdailanavrhtp

    Sequence, based on observed residues (ATOM records): (download) 
    >1ny9A (A:)
wqriqdeadeltrrfvalmdagepadsegamdaaedhrqgiarnhydcgyemhtclgemy
vsderftrnidaakpglaaymrdailanavrhtp