PDB entry 1nx7

View 1nx7 on RCSB PDB site
Description: Solution Structure of Oxidized Bovine Microsomal Cytochrome B5
Class: electron transport
Keywords: five helix, five sheet, heme ring, electron transport
Deposited on 2003-02-10, released 2004-06-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: cytochrome b5
  Species: Bos taurus [TaxId:9913]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00171 (0-81)
  Domains in SCOPe 2.08: d1nx7a_
• Heterogens: HEM

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1nx7A (A:)
  avkyytleeiqkhnnskstwlilhykvydltkfleehpggeevlreqaggdatenfedvg
  hstdarelsktfiigelhpddr