Lineage for d1nx7a_ (1nx7 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2973074Fold d.120: Cytochrome b5-like heme/steroid binding domain [55855] (1 superfamily)
    beta-alpha-beta(2)-alpha(1,2)-(beta)-alpha(2)-beta; 3 layers: a/b/a; antiparallel beta-sheet, order: 1532(4)
  4. 2973075Superfamily d.120.1: Cytochrome b5-like heme/steroid binding domain [55856] (3 families) (S)
  5. 2973076Family d.120.1.1: Cytochrome b5 [55857] (5 proteins)
  6. 2973077Protein Cytochrome b5 [55858] (4 species)
  7. 2973078Species Cow (Bos taurus) [TaxId:9913] [55859] (18 PDB entries)
    Uniprot P00171 7-88 ! Uniprot P00171 8-89
  8. 2973092Domain d1nx7a_: 1nx7 A: [103875]
    complexed with hem

Details for d1nx7a_

PDB Entry: 1nx7 (more details)

PDB Description: solution structure of oxidized bovine microsomal cytochrome b5
PDB Compounds: (A:) cytochrome b5

SCOPe Domain Sequences for d1nx7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nx7a_ d.120.1.1 (A:) Cytochrome b5 {Cow (Bos taurus) [TaxId: 9913]}
avkyytleeiqkhnnskstwlilhykvydltkfleehpggeevlreqaggdatenfedvg
hstdarelsktfiigelhpddr

SCOPe Domain Coordinates for d1nx7a_:

Click to download the PDB-style file with coordinates for d1nx7a_.
(The format of our PDB-style files is described here.)

Timeline for d1nx7a_: